Name |
Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-2 subunit |
Synonyms |
3513 |
Gene name |
GNG2 |
General function |
Involved in signal transducer activity |
Specific function |
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction |
Gene sequence |
+ ...
ATGGCCAGCAACAACACCGCCAGCATAGCACAAGCCAGGAAGCTGGTAGAGCAGCTTAAGATGGAAGCCAATATCGACAGGATAAAGGTGTCCAAGGCAGCTGCAGATTTGATGGCCTACTGTGAAGCACATGCCAAGGAAGACCCCCTCCTGACCCCTGTTCCGGCTTCAGAAAACCCGTTTAGGGAGAAGAAGTTTTTCTGTGCCATCCTTTAA
|
Protein sequence |
+ ...
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
|
GO Classification |
component |
extrinsic to membrane |
extrinsic to plasma membrane |
heterotrimeric G-protein complex |
cell |
membrane |
function |
signal transducer activity |
process |
cellular process |
cell communication |
signal transduction |
cell surface receptor linked signal transduction |
G-protein coupled receptor protein signaling pathway |
|
See more information at →
www.drugbank.ca
|