| Name |
Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-2 subunit |
| Synonyms |
3513 |
| Gene name |
GNG2 |
| General function |
Involved in signal transducer activity |
| Specific function |
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction |
| Gene sequence |
+ ...
ATGGCCAGCAACAACACCGCCAGCATAGCACAAGCCAGGAAGCTGGTAGAGCAGCTTAAGATGGAAGCCAATATCGACAGGATAAAGGTGTCCAAGGCAGCTGCAGATTTGATGGCCTACTGTGAAGCACATGCCAAGGAAGACCCCCTCCTGACCCCTGTTCCGGCTTCAGAAAACCCGTTTAGGGAGAAGAAGTTTTTCTGTGCCATCCTTTAA
|
| Protein sequence |
+ ...
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
|
| GO Classification |
| component |
| extrinsic to membrane |
| extrinsic to plasma membrane |
| heterotrimeric G-protein complex |
| cell |
| membrane |
| function |
| signal transducer activity |
| process |
| cellular process |
| cell communication |
| signal transduction |
| cell surface receptor linked signal transduction |
| G-protein coupled receptor protein signaling pathway |
|
|
See more information at →
www.drugbank.ca
|