| Name |
50S ribosomal protein L32 |
| Synonyms |
8127 |
| Gene name |
rpmF |
| General function |
Translation, ribosomal structure and biogenesis |
| Specific function |
Forms a cluster with L17 and L22, and with L22, a pair of "tweezers" that hold together all the domains of the 23S rRNA. Interacts with the antibiotic troleandomycin which blocks the peptide exit tunnel |
| Gene sequence |
+ ...
ATGGCCAAACACCCCGTTCCCAAGAAGAAGACCAGCAAGAGCAAGCGCGACATGCGCCGCAGCCACCACGCGCTGACCGCCCCCAACCTGACCGAGTGCCCCCAGTGCCACGGCAAGAAGCTCTCGCACCACATCTGCCCCAACTGCGGCTATTACGATGGCCGTCAGGTGCTCGCGGTCTAA
|
| Protein sequence |
+ ...
MAKHPVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGYYDGRQVLAV
|
| GO Classification |
| component |
| ribosome |
| large ribosomal subunit |
| protein complex |
| ribonucleoprotein complex |
| function |
| structural molecule activity |
| structural constituent of ribosome |
| process |
| physiological process |
| metabolism |
| macromolecule metabolism |
| macromolecule biosynthesis |
| protein biosynthesis |
|
|
See more information at →
www.drugbank.ca
|