Name |
50S ribosomal protein L32 |
Synonyms |
8127 |
Gene name |
rpmF |
General function |
Translation, ribosomal structure and biogenesis |
Specific function |
Forms a cluster with L17 and L22, and with L22, a pair of "tweezers" that hold together all the domains of the 23S rRNA. Interacts with the antibiotic troleandomycin which blocks the peptide exit tunnel |
Gene sequence |
+ ...
ATGGCCAAACACCCCGTTCCCAAGAAGAAGACCAGCAAGAGCAAGCGCGACATGCGCCGCAGCCACCACGCGCTGACCGCCCCCAACCTGACCGAGTGCCCCCAGTGCCACGGCAAGAAGCTCTCGCACCACATCTGCCCCAACTGCGGCTATTACGATGGCCGTCAGGTGCTCGCGGTCTAA
|
Protein sequence |
+ ...
MAKHPVPKKKTSKSKRDMRRSHHALTAPNLTECPQCHGKKLSHHICPNCGYYDGRQVLAV
|
GO Classification |
component |
ribosome |
large ribosomal subunit |
protein complex |
ribonucleoprotein complex |
function |
structural molecule activity |
structural constituent of ribosome |
process |
physiological process |
metabolism |
macromolecule metabolism |
macromolecule biosynthesis |
protein biosynthesis |
|
See more information at →
www.drugbank.ca
|