| Name |
Potassium voltage-gated channel subfamily E member 1 |
| Synonyms |
1607 |
| Gene name |
KCNE1 |
| General function |
Involved in voltage-gated potassium channel activity |
| Specific function |
Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNQ1/KVLQT1 is proposed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel. The outward current reaches its steady state only after 50 seconds. Assembled with KCNH2/HERG may modulate the rapidly activating component of the delayed rectifying potassium current in heart (IKr) |
| Gene sequence |
+ ...
ATGATCCTGTCTAACACCACAGCGGTGACGCCCTTTCTGACCAAGCTGTGGCAGGAGACAGTTCAGCAGGGTGGCAACATGTCGGGCCTGGCCCGCAGGTCCCCCCGCAGCAGTGACGGCAAGCTGGAGGCCCTCTACGTCCTCATGGTACTGGGATTCTTCGGCTTCTTCACCCTGGGCATCATGCTGAGCTACATCCGCTCCAAGAAGCTGGAGCACTCGAACGACCCATTCAACGTCTACATCGAGTCCGATGCCTGGCAAGAGAAGGACAAGGCCTATGTCCAGGCCCGGGTCCTGGAGAGCTACAGGTCGTGCTATGTCGTTGAAAACCATCTGGCCATAGAACAACCCAACACACACCTTCCTGAGACGAAGCCTTCCCCATGA
|
| Protein sequence |
+ ...
MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
|
| GO Classification |
| component |
| membrane |
| cell |
| function |
| voltage-gated potassium channel activity |
| transporter activity |
| ion transporter activity |
| ion channel activity |
| voltage-gated ion channel activity |
| process |
| ion transport |
| cation transport |
| monovalent inorganic cation transport |
| physiological process |
| potassium ion transport |
| cellular physiological process |
| transport |
|
|
See more information at →
www.drugbank.ca
|