Name |
Cytochrome c3, 13 kDa |
Synonyms |
7296 |
Gene name |
Not Available |
General function |
Involved in iron ion binding |
Specific function |
Participates in sulfate respiration coupled with phosphorylation by transferring electrons from the enzyme dehydrogenase to ferredoxin |
Gene sequence |
+ ...
Not Available
|
Protein sequence |
+ ...
ADAPGDDYVISAPEGMKAKPKGDKPGALQKTVPFPHTKHATVECVQCHHTLEADGGAVKKCTTSGCHDSLEFRDKANAKDIKLVENAFHTQCIDCHKALKKDKKPTGPTACGKCHTTN
|
GO Classification |
function |
tetrapyrrole binding |
binding |
heme binding |
ion binding |
cation binding |
transition metal ion binding |
iron ion binding |
transporter activity |
electron transporter activity |
process |
cellular metabolism |
generation of precursor metabolites and energy |
electron transport |
physiological process |
energy derivation by oxidation of organic compounds |
cellular respiration |
aerobic respiration |
aerobic respiration, using sulfur or sulfate as electron donor |
metabolism |
|
See more information at →
www.drugbank.ca
|