| Name |
DNA polymerase epsilon subunit 3 |
| Synonyms |
7959 |
| Gene name |
POLE3 |
| General function |
Chromatin structure and dynamics |
| Specific function |
Forms a complex with DNA polymerase epsilon subunit CHRAC1 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome-remodeling activity of ISWI/SNF2H and ACF1 |
| Gene sequence |
+ ...
Not Available
|
| Protein sequence |
+ ...
MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN
|
| GO Classification |
| function |
| binding |
| nucleic acid binding |
| DNA binding |
|
|
See more information at →
www.drugbank.ca
|