| Name |
Nucleoside-specific channel-forming protein tsx precursor |
| Synonyms |
5789 |
| Gene name |
tsx |
| General function |
Cell wall/membrane/envelope biogenesis |
| Specific function |
Constitutes the receptor for colicin K and phage T6, and functions as substrate-specific channel for nucleosides and deoxynucleosides |
| Gene sequence |
+ ...
Not Available
|
| Protein sequence |
+ ...
MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSYHTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEPRFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSGNAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRSTGWGGYLVVGYNF
|
| GO Classification |
| component |
| cell |
| membrane |
| outer membrane |
| outer membrane (sensu Gram-negative Bacteria) |
| function |
| transporter activity |
| nucleobase, nucleoside, nucleotide and nucleic acid transporter activity |
| nucleoside transporter activity |
|
|
See more information at →
www.drugbank.ca
|