| Name |
30S ribosomal protein S12 |
| Synonyms |
3291 |
| Gene name |
rpsL |
| General function |
Translation, ribosomal structure and biogenesis |
| Specific function |
Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit |
| Gene sequence |
+ ...
GTGGTGGCACTGCCGACGATCAATCAGCTCGTCCGAAAGGGCCGCGAGAAGGTCCGCAAAAAGAGCAAGGTTCCGGCGTTGAAGGGGGCGCCCTTCCGCCGGGGGGTGTGCACCGTGGTGCGCACCGTCACCCCCAAGAAGCCCAACTCGGCGCTCCGTAAGGTGGCCAAGGTGCGCCTCACCTCCGGCTACGAGGTGACCGCCTACATCCCCGGCGAGGGGCACAACCTTCAGGAGCACTCGGTGGTCCTCATCCGGGGCGGCCGTGTGAAGGACCTGCCGGGCGTGCGCTACCACATCGTGCGCGGGGTCTACGACGCCGCCGGGGTGAAGGACCGGAAGAAGAGCCGCTCCAAGTACGGGACCAAGAAGCCCAAGGAGGCGGCCAAGACCGCGGCCAAGAAGTAG
|
| Protein sequence |
+ ...
MPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK
|
| GO Classification |
| component |
| ribonucleoprotein complex |
| ribosome |
| small ribosomal subunit |
| cell |
| intracellular |
| protein complex |
| function |
| structural molecule activity |
| structural constituent of ribosome |
| process |
| protein biosynthesis |
| physiological process |
| metabolism |
| macromolecule metabolism |
| macromolecule biosynthesis |
|
|
See more information at →
www.drugbank.ca
|