| Name |
30S ribosomal protein S10 |
| Synonyms |
8127 |
| Gene name |
rpsJ |
| General function |
Translation, ribosomal structure and biogenesis |
| Specific function |
Part of the top of the 30S subunit head |
| Gene sequence |
+ ...
Not Available
|
| Protein sequence |
+ ...
MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTVGGGR
|
| GO Classification |
| component |
| ribonucleoprotein complex |
| ribosome |
| small ribosomal subunit |
| cell |
| intracellular |
| protein complex |
| function |
| structural molecule activity |
| structural constituent of ribosome |
| process |
| protein biosynthesis |
| physiological process |
| metabolism |
| macromolecule metabolism |
| macromolecule biosynthesis |
|
|
See more information at →
www.drugbank.ca
|