Name |
Nucleoside-specific channel-forming protein tsx precursor |
Synonyms |
5789 |
Gene name |
tsx |
General function |
Cell wall/membrane/envelope biogenesis |
Specific function |
Constitutes the receptor for colicin K and phage T6, and functions as substrate-specific channel for nucleosides and deoxynucleosides |
Gene sequence |
+ ...
Not Available
|
Protein sequence |
+ ...
MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSYHTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEPRFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSGNAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRSTGWGGYLVVGYNF
|
GO Classification |
component |
cell |
membrane |
outer membrane |
outer membrane (sensu Gram-negative Bacteria) |
function |
transporter activity |
nucleobase, nucleoside, nucleotide and nucleic acid transporter activity |
nucleoside transporter activity |
|
See more information at →
www.drugbank.ca
|