| Name |
Somatostatin receptor type 2 |
| Synonyms |
7753 |
| Gene name |
SSTR2 |
| General function |
Not Available |
| Specific function |
Receptor for somatostatins-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. In RIN-5F cells, this receptor inhibits calcium entry by suppressing voltage dependent calcium-channels |
| Gene sequence |
+ ...
Not Available
|
| Protein sequence |
+ ...
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
|
| GO Classification |
| component |
| cell |
| intrinsic to membrane |
| integral to membrane |
| membrane |
| function |
| peptide receptor activity, G-protein coupled |
| neuropeptide receptor activity |
| somatostatin receptor activity |
| signal transducer activity |
| receptor activity |
| transmembrane receptor activity |
| G-protein coupled receptor activity |
| rhodopsin-like receptor activity |
| process |
| cellular process |
| cell communication |
| signal transduction |
| cell surface receptor linked signal transduction |
| G-protein coupled receptor protein signaling pathway |
|
|
See more information at →
www.drugbank.ca
|