Name |
Somatostatin receptor type 2 |
Synonyms |
7753 |
Gene name |
SSTR2 |
General function |
Not Available |
Specific function |
Receptor for somatostatins-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. In RIN-5F cells, this receptor inhibits calcium entry by suppressing voltage dependent calcium-channels |
Gene sequence |
+ ...
Not Available
|
Protein sequence |
+ ...
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
|
GO Classification |
component |
cell |
intrinsic to membrane |
integral to membrane |
membrane |
function |
peptide receptor activity, G-protein coupled |
neuropeptide receptor activity |
somatostatin receptor activity |
signal transducer activity |
receptor activity |
transmembrane receptor activity |
G-protein coupled receptor activity |
rhodopsin-like receptor activity |
process |
cellular process |
cell communication |
signal transduction |
cell surface receptor linked signal transduction |
G-protein coupled receptor protein signaling pathway |
|
See more information at →
www.drugbank.ca
|