| Name |
Ribosomal small subunit pseudouridine synthase A |
| Synonyms |
4157 |
| Gene name |
rsuA |
| General function |
Translation, ribosomal structure and biogenesis |
| Specific function |
Responsible for synthesis of pseudouridine from uracil- 516 in 16S ribosomal RNA |
| Gene sequence |
+ ...
Not Available
|
| Protein sequence |
+ ...
MRLDKFIAQQLGVSRAIAGREIRGNRVTVDGEIVRNAAFKLLPEHDVAYDGNPLAQQHGPRYFMLNKPQGYVCSTDDPDHPTVLYFLDEPVAWKLHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESPVADDTAEQFAKGVQLHNEKDLTKPAVLEVITPTQVRLTISEGRYHQVKRMFAAVGNHVVELHRERIGGITLDADLAPGEYRPLTEEEIASVV
|
| GO Classification |
| function |
| isomerase activity |
| carbon-oxygen lyase activity |
| hydro-lyase activity |
| binding |
| intramolecular transferase activity |
| pseudouridylate synthase activity |
| catalytic activity |
| pseudouridine synthase activity |
| lyase activity |
| nucleic acid binding |
| RNA binding |
| process |
| nucleobase, nucleoside, nucleotide and nucleic acid metabolism |
| RNA metabolism |
| physiological process |
| metabolism |
| RNA processing |
| cellular metabolism |
|
|
See more information at →
www.drugbank.ca
|