Name |
30S ribosomal protein S13 |
Synonyms |
3291 |
Gene name |
rpsM |
General function |
Translation, ribosomal structure and biogenesis |
Specific function |
Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome structure it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the top of the two subunits; these bridges are in contact with the A site and P site tRNAs respectively and are implicated in movement during ribosome translocation. Separately contacts the tRNAs in the A and P sites |
Gene sequence |
+ ...
ATGAAGGTGCGCGCGTCGGTCAAGAGGATCTGCGACAAGTGCAAGGTGATCCGCCGGCACGGGCGGGTCTACGTCATCTGCGAGAACCCCAAGCATAAGCAGCGGCAGGGTTAG
|
Protein sequence |
+ ...
MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
|
GO Classification |
component |
ribonucleoprotein complex |
ribosome |
cell |
intracellular |
protein complex |
function |
structural molecule activity |
structural constituent of ribosome |
binding |
nucleic acid binding |
RNA binding |
process |
macromolecule biosynthesis |
protein biosynthesis |
physiological process |
metabolism |
macromolecule metabolism |
|
See more information at →
www.drugbank.ca
|