Name |
30S ribosomal protein S13 |
Synonyms |
8227 |
Gene name |
rpsM |
General function |
Translation, ribosomal structure and biogenesis |
Specific function |
The C-terminal tail plays a role in the affinity of the 30S P site for different tRNAs |
Gene sequence |
+ ...
GTGGCCCGTATAGCAGGCATTAACATTCCTGATCATAAGCATGCCGTAATCGCATTAACTTCGATTTATGGCGTCGGCAAGACCCGTTCTAAAGCCATCCTGGCTGCAGCGGGTATCGCTGAAGATGTTAAGATCAGTGAGCTGTCTGAAGGACAAATCGACACGCTGCGTGACGAAGTTGCCAAATTTGTCGTTGAAGGTGATCTGCGCCGTGAAATCAGCATGAGCATCAAGCGCCTGATGGATCTTGGTTGCTATCGCGGTTTGCGTCATCGTCGTGGTCTCCCGGTTCGCGGTCAGCGTACCAAGACCAACGCACGTACCCGTAAGGGTCCGCGCAAACCGATCAAGAAATAA
|
Protein sequence |
+ ...
MARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK
|
GO Classification |
component |
ribonucleoprotein complex |
ribosome |
cell |
intracellular |
protein complex |
function |
structural molecule activity |
structural constituent of ribosome |
binding |
nucleic acid binding |
RNA binding |
process |
macromolecule biosynthesis |
protein biosynthesis |
physiological process |
metabolism |
macromolecule metabolism |
|
See more information at →
www.drugbank.ca
|