Name |
Lantibiotic nisin-Z |
Synonyms |
4220 |
Gene name |
nisZ |
General function |
Involved in receptor binding |
Specific function |
Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores |
Gene sequence |
+ ...
ATGAGTACAAAAGATTTTAACTTGGATTTGGTATCTGTTTCGAAGAAAGATTCAGGTGCATCACCACGCATTACAAGTATTTCGCTATGTACACCCGGTTGTAAAACAGGAGCTCTGATGGGTTGTAACATGAAAACAGCAACTTGTAATTGTAGTATTCACGTAAGCAAATAA
|
Protein sequence |
+ ...
MSTKDFNLDLVSVSKKDSGASPRITSISLCTPGCKTGALMGCNMKTATCNCSIHVSK
|
GO Classification |
process |
response to stimulus |
response to biotic stimulus |
defense response |
defense response to bacteria |
defense response to Gram-positive bacteria |
|
See more information at →
www.drugbank.ca
|