| Name |
Lantibiotic nisin-Z |
| Synonyms |
4220 |
| Gene name |
nisZ |
| General function |
Involved in receptor binding |
| Specific function |
Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores |
| Gene sequence |
+ ...
ATGAGTACAAAAGATTTTAACTTGGATTTGGTATCTGTTTCGAAGAAAGATTCAGGTGCATCACCACGCATTACAAGTATTTCGCTATGTACACCCGGTTGTAAAACAGGAGCTCTGATGGGTTGTAACATGAAAACAGCAACTTGTAATTGTAGTATTCACGTAAGCAAATAA
|
| Protein sequence |
+ ...
MSTKDFNLDLVSVSKKDSGASPRITSISLCTPGCKTGALMGCNMKTATCNCSIHVSK
|
| GO Classification |
| process |
| response to stimulus |
| response to biotic stimulus |
| defense response |
| defense response to bacteria |
| defense response to Gram-positive bacteria |
|
|
See more information at →
www.drugbank.ca
|