Partner ID | 3780 | ||
Name | Lipoprotein nlpI precursor | ||
Synonyms | 5801 | ||
Gene name | nlpI | ||
General function | Not Available | ||
Specific function | May be involved in cell division. Overexpression of nlpI results in the loss of the rod morphology and the formation of single prolate ellipsoids and pairs of prolate ellipsoids joined by partial constrictions | ||
Gene sequence |
+ ...
Not Available |
||
Protein sequence |
+ ...
MKPFLRWCFVATALTLAGCSNTSWRKSEVLAVPLQPTLQQEVILARMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRSLWLYLAEQKLDEKQAKEVLKQHFEKSDKEQWGWNIVEFYLGNISEQTLMERLKADATDNTSLAEHLSETNFYLGKYYLSLGDLDSATALFKLAVANNVHNFVEHRYALLELSLLGQDQDDLAESDQQ |
||
GO Classification |
|
||
See more information at → www.drugbank.ca |
Id | Name |
---|---|
DB03754 | Tris(Hydroxymethyl)Aminomethane |