Name |
30S ribosomal protein S3 |
Synonyms |
1567 |
Gene name |
rpsC |
General function |
Translation, ribosomal structure and biogenesis |
Specific function |
Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation (By similarity) |
Gene sequence |
+ ...
Not Available
|
Protein sequence |
+ ...
MGNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEVIGGQKPKARPELPKAEERPRRRRPAVRVKKEE
|
GO Classification |
component |
ribonucleoprotein complex |
ribosome |
small ribosomal subunit |
cell |
intracellular |
protein complex |
function |
structural constituent of ribosome |
binding |
nucleic acid binding |
structural molecule activity |
process |
macromolecule biosynthesis |
protein biosynthesis |
physiological process |
metabolism |
macromolecule metabolism |
|
See more information at →
www.drugbank.ca
|