| Name |
30S ribosomal protein S7 |
| Synonyms |
8952 |
| Gene name |
rpsG |
| General function |
Translation, ribosomal structure and biogenesis |
| Specific function |
One of the primary rRNA binding proteins, it binds directly to 3'-end of the 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center. Binds mRNA and the E site tRNA blocking its exit path in the ribosome. This blockage implies that this section of the ribosome must be able to move to release the deacetylated tRNA |
| Gene sequence |
+ ...
GTGGTGGCACTGCCGACGATCAATCAGCTCGTCCGAAAGGGCCGCGAGAAGGTCCGCAAAAAGAGCAAGGTTCCGGCGTTGAAGGGGGCGCCCTTCCGCCGGGGGGTGTGCACCGTGGTGCGCACCGTCACCCCCAAGAAGCCCAACTCGGCGCTCCGTAAGGTGGCCAAGGTGCGCCTCACCTCCGGCTACGAGGTGACCGCCTACATCCCCGGCGAGGGGCACAACCTTCAGGAGCACTCGGTGGTCCTCATCCGGGGCGGCCGTGTGAAGGACCTGCCGGGCGTGCGCTACCACATCGTGCGCGGGGTCTACGACGCCGCCGGGGTGAAGGACCGGAAGAAGAGCCGCTCCAAGTACGGGACCAAGAAGCCCAAGGAGGCGGCCAAGACCGCGGCCAAGAAGTAG
|
| Protein sequence |
+ ...
MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW
|
| GO Classification |
| component |
| ribonucleoprotein complex |
| ribosome |
| small ribosomal subunit |
| cell |
| intracellular |
| protein complex |
| function |
| structural molecule activity |
| structural constituent of ribosome |
| process |
| protein biosynthesis |
| physiological process |
| metabolism |
| macromolecule metabolism |
| macromolecule biosynthesis |
|
|
See more information at →
www.drugbank.ca
|