Name |
30S ribosomal protein S14 type Z |
Synonyms |
3291 |
Gene name |
rpsZ |
General function |
Translation, ribosomal structure and biogenesis |
Specific function |
Required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site (By similarity). Binds 16S rRNA in center of the 30S subunit head |
Gene sequence |
+ ...
ATGCCTAAGAAGGTGCTGACCGGGGTGGTGGTGAGCGACAAGATGCAGAAGACCGTGACGGTCTTGGTGGAGCGCCAGTTCCCCCACCCCCTTTACGGCAAGGTCATCAAGCGCTCCAAAAAGTACCTGGCCCATGACCCCGAGGAGCGGTACAAGGTGGGGGACGTGGTGGAGATCATAGAGGCCCGCCCCATCTCCAAGCGCAAGCGATTCCGGGTCCTGCGCTTGGTGGAAGAGGGGCGGCTGGACCTGGTGGAGAAGTACCTGGTACGCCGCCAGAACTACGCTAGCCTTTCCAAGCGGGGAGGTAAGGCATGA
|
Protein sequence |
+ ...
MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
|
GO Classification |
component |
cell |
intracellular |
protein complex |
ribonucleoprotein complex |
ribosome |
function |
structural molecule activity |
structural constituent of ribosome |
process |
physiological process |
metabolism |
macromolecule metabolism |
macromolecule biosynthesis |
protein biosynthesis |
|
See more information at →
www.drugbank.ca
|