Name |
30S ribosomal protein S11 |
Synonyms |
3291 |
Gene name |
rpsK |
General function |
Translation, ribosomal structure and biogenesis |
Specific function |
Located on the upper part of the platform of the 30S subunit, where it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome, where it interacts both with the Shine-Dalgarno helix and mRNA |
Gene sequence |
+ ...
ATGAAGGTGCGCGCGTCGGTCAAGAGGATCTGCGACAAGTGCAAGGTGATCCGCCGGCACGGGCGGGTCTACGTCATCTGCGAGAACCCCAAGCATAAGCAGCGGCAGGGTTAG
|
Protein sequence |
+ ...
MAKKPSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
|
GO Classification |
component |
ribonucleoprotein complex |
ribosome |
cell |
intracellular |
protein complex |
function |
structural molecule activity |
structural constituent of ribosome |
process |
protein biosynthesis |
physiological process |
metabolism |
macromolecule metabolism |
macromolecule biosynthesis |
|
See more information at →
www.drugbank.ca
|