| Name |
30S ribosomal protein S3 |
| Synonyms |
1567 |
| Gene name |
rpsC |
| General function |
Translation, ribosomal structure and biogenesis |
| Specific function |
Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation (By similarity) |
| Gene sequence |
+ ...
Not Available
|
| Protein sequence |
+ ...
MGNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEVIGGQKPKARPELPKAEERPRRRRPAVRVKKEE
|
| GO Classification |
| component |
| ribonucleoprotein complex |
| ribosome |
| small ribosomal subunit |
| cell |
| intracellular |
| protein complex |
| function |
| structural constituent of ribosome |
| binding |
| nucleic acid binding |
| structural molecule activity |
| process |
| macromolecule biosynthesis |
| protein biosynthesis |
| physiological process |
| metabolism |
| macromolecule metabolism |
|
|
See more information at →
www.drugbank.ca
|