| Name |
30S ribosomal protein S20 |
| Synonyms |
3291 |
| Gene name |
rpsT |
| General function |
Translation, ribosomal structure and biogenesis |
| Specific function |
One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the bottom of the body of the 30S subunit, by binding to several RNA helices of the 16S rRNA |
| Gene sequence |
+ ...
ATGGCGCAGAAGAAGCCCAAGAGGAACCTTTCCGCCCTTAAGCGGCACCGGCAGTCCCTGAAGCGCCGGCTCCGCAACAAGGCCAAGAAGTCGGCCATCAAGACCCTCAGCAAGAAGGCCATCCAGCTGGCCCAGGAGGGCAAGGCGGAAGAGGCCCTGAAGATCATGCGCAAGGCCGAAAGCCTCATTGACAAGGCGGCGAAGGGCTCCACCCTGCACAAGAACGCCGCTGCCCGCAGGAAGTCCCGGCTGATGCGCAAGGTCCGTCAGCTGCTCGAGGCCGCGGGGGCGCCCCTCATTGGCGGCGGCCTCAGCGCCTAA
|
| Protein sequence |
+ ...
MAQKKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
|
| GO Classification |
| component |
| ribonucleoprotein complex |
| ribosome |
| cell |
| intracellular |
| protein complex |
| function |
| structural molecule activity |
| structural constituent of ribosome |
| binding |
| nucleic acid binding |
| RNA binding |
| process |
| macromolecule biosynthesis |
| protein biosynthesis |
| physiological process |
| metabolism |
| macromolecule metabolism |
|
|
See more information at →
www.drugbank.ca
|