| Name |
30S ribosomal protein S11 |
| Synonyms |
3291 |
| Gene name |
rpsK |
| General function |
Translation, ribosomal structure and biogenesis |
| Specific function |
Located on the upper part of the platform of the 30S subunit, where it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome, where it interacts both with the Shine-Dalgarno helix and mRNA |
| Gene sequence |
+ ...
ATGAAGGTGCGCGCGTCGGTCAAGAGGATCTGCGACAAGTGCAAGGTGATCCGCCGGCACGGGCGGGTCTACGTCATCTGCGAGAACCCCAAGCATAAGCAGCGGCAGGGTTAG
|
| Protein sequence |
+ ...
MAKKPSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
|
| GO Classification |
| component |
| ribonucleoprotein complex |
| ribosome |
| cell |
| intracellular |
| protein complex |
| function |
| structural molecule activity |
| structural constituent of ribosome |
| process |
| protein biosynthesis |
| physiological process |
| metabolism |
| macromolecule metabolism |
| macromolecule biosynthesis |
|
|
See more information at →
www.drugbank.ca
|