| Partner ID | 6368 | |||||||
| Name | Dehydrosqualene synthase | |||||||
| Synonyms | 8504 | |||||||
| Gene name | crtM | |||||||
| General function | Lipid transport and metabolism | |||||||
| Specific function | Catalyzes the head-to-head condensation of two molecules of farnesyl diphosphate (FPP) into the colorless C(30) carotenoid dehydrosqualene (4,4'-diapophytoene). This is the initial step in the biosynthesis of staphyloxanthin, an orange carotenoid present in most staphylococci strains | |||||||
| Gene sequence |
+ ...
Not Available |
|||||||
| Protein sequence |
+ ...
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKYHRI |
|||||||
| GO Classification |
|
|||||||
| See more information at → www.drugbank.ca | ||||||||