| Name |
Placenta growth factor |
| Synonyms |
7396 |
| Gene name |
PGF |
| General function |
Involved in growth factor activity |
| Specific function |
Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration. It binds to receptor VEGFR-1/FLT1. PLGF-2 binds neuropilin-1 and 2 in a heparin-dependent manner |
| Gene sequence |
+ ...
Not Available
|
| Protein sequence |
+ ...
MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR
|
| GO Classification |
| component |
| cell |
| membrane |
| function |
| signal transducer activity |
| growth factor activity |
| receptor binding |
|
|
See more information at →
www.drugbank.ca
|