Partner ID | 4551 |
Name | Lantibiotic mersacidin |
Synonyms | 6947 |
Gene name | mrsA |
General function | Not Available |
Specific function | Kills a number of Gram-positive bacteria. Acts at the level of cell wall biosynthesis by interfering with bacterial peptidoglycan biosynthesis. Specifically inhibits the conversion of the lipid II intermediate into polymeric nascent glycan strands by transglycosylation. May interact with the peptidoglycan precursor rather than with the enzyme |
Gene sequence |
+ ...
ATGAGTCAAGAAGCTATCATTCGTTCATGGAAAGATCCTTTTTCCCGTGAAAATTCTACACAAAATCCAGCTGGTAACCCATTCAGTGAGCTGAAAGAAGCACAAATGGATAAGTTAGTAGGTGCGGGAGACATGGAAGCAGCATGTACTTTTACATTGCCTGGTGGCGGCGGTGTTTGTACTCTAACTTCTGAATGTATTTGTTAA |
Protein sequence |
+ ...
MSQEAIIRSWKDPFSRENSTQNPAGNPFSELKEAQMDKLVGAGDMEAACTFTLPGGGGVCTLTSECIC |
GO Classification | Not Available |
See more information at → www.drugbank.ca |
Id | Name |
---|---|
DB01968 | 2-Thioethenamine |
DB02688 | 2,3-Didehydroalanine |
DB04454 | Alpha-Aminobutyric Acid |