| Name |
Formate dehydrogenase, nitrate-inducible, cytochrome b556(fdn) subunit |
| Synonyms |
8874 |
| Gene name |
fdnI |
| General function |
Energy production and conversion |
| Specific function |
Formate dehydrogenase allows E.coli to use formate as major electron donor during anaerobic respiration, when nitrate is used as electron acceptor. Subunit gamma is the cytochrome b556(FDN) component of the formate dehydrogenase |
| Gene sequence |
+ ...
Not Available
|
| Protein sequence |
+ ...
MSKSKMIVRTKFIDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHPFFGIAIFVALMFMFVRFVHHNIPDKKDIPWLLNIVEVLKGNEHKVADVGKYNAGQKMMFWSIMSMIFVLLVTGVIIWRPYFAQYFPMQVVRYSLLIHAAAGIILIHAILIHMYMAFWVKGSIKGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGI
|
| GO Classification |
| component |
| intrinsic to membrane |
| integral to membrane |
| membrane |
| protein complex |
| unlocalized protein complex |
| formate dehydrogenase complex |
| cell |
| function |
| oxidoreductase activity, acting on the aldehyde or oxo group of donors |
| oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor |
| catalytic activity |
| oxidoreductase activity |
| formate dehydrogenase activity |
| process |
| physiological process |
| cellular respiration |
| metabolism |
| cellular metabolism |
| generation of precursor metabolites and energy |
| energy derivation by oxidation of organic compounds |
|
|
See more information at →
www.drugbank.ca
|