| Name |
Cytochrome c' |
| Synonyms |
7222 |
| Gene name |
Not Available |
| General function |
Involved in iron ion binding |
| Specific function |
Cytochrome c' is the most widely occurring bacterial c- type cytochrome. Cytochromes c' are high-spin proteins and the heme has no sixth ligand. Their exact function is not known |
| Gene sequence |
+ ...
Not Available
|
| Protein sequence |
+ ...
QFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
|
| GO Classification |
| component |
| cell |
| membrane |
| organelle membrane |
| organelle inner membrane |
| mitochondrial inner membrane |
| periplasmic space |
| mitochondrial electron transport chain |
| function |
| tetrapyrrole binding |
| binding |
| heme binding |
| ion binding |
| cation binding |
| transition metal ion binding |
| iron ion binding |
| transporter activity |
| electron transporter activity |
| process |
| cellular metabolism |
| generation of precursor metabolites and energy |
| electron transport |
| physiological process |
| metabolism |
|
|
See more information at →
www.drugbank.ca
|