Name |
Cytochrome c' |
Synonyms |
7222 |
Gene name |
Not Available |
General function |
Involved in iron ion binding |
Specific function |
Cytochrome c' is the most widely occurring bacterial c- type cytochrome. Cytochromes c' are high-spin proteins and the heme has no sixth ligand. Their exact function is not known |
Gene sequence |
+ ...
Not Available
|
Protein sequence |
+ ...
QFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
|
GO Classification |
component |
cell |
membrane |
organelle membrane |
organelle inner membrane |
mitochondrial inner membrane |
periplasmic space |
mitochondrial electron transport chain |
function |
tetrapyrrole binding |
binding |
heme binding |
ion binding |
cation binding |
transition metal ion binding |
iron ion binding |
transporter activity |
electron transporter activity |
process |
cellular metabolism |
generation of precursor metabolites and energy |
electron transport |
physiological process |
metabolism |
|
See more information at →
www.drugbank.ca
|