Name |
Outer-membrane lipoprotein lolB |
Synonyms |
9054 |
Gene name |
lolB |
General function |
Cell wall/membrane/envelope biogenesis |
Specific function |
Plays a critical role in the incorporation of lipoproteins in the outer membrane after they are released by the lolA protein. Essential for E.coli viability |
Gene sequence |
+ ...
ATGTCTGCGGGAAATAATACCAACGTTGATAGGGTTAGTCTGCTTGCATCATACATACAGGATGCGTAA
|
Protein sequence |
+ ...
MPLPDFRLIRLLPLAALVLTACSVTTPKGPGKSPDSPQWRQHQQDVRNLNQYQTRGAFAYISDQQKVYARFFWQQTGQDRYRLLLTNPLGSTELELNAQPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQYRLSEITYSQNGKNWKVVYGGYDTKTQPAMPANMELTDGGQRIKLKMDNWIVK
|
GO Classification |
component |
cell |
membrane |
outer membrane |
outer membrane (sensu Gram-negative Bacteria) |
process |
physiological process |
cellular physiological process |
transport |
protein transport |
|
See more information at →
www.drugbank.ca
|