| Name |
Outer-membrane lipoprotein lolB |
| Synonyms |
9054 |
| Gene name |
lolB |
| General function |
Cell wall/membrane/envelope biogenesis |
| Specific function |
Plays a critical role in the incorporation of lipoproteins in the outer membrane after they are released by the lolA protein. Essential for E.coli viability |
| Gene sequence |
+ ...
ATGTCTGCGGGAAATAATACCAACGTTGATAGGGTTAGTCTGCTTGCATCATACATACAGGATGCGTAA
|
| Protein sequence |
+ ...
MPLPDFRLIRLLPLAALVLTACSVTTPKGPGKSPDSPQWRQHQQDVRNLNQYQTRGAFAYISDQQKVYARFFWQQTGQDRYRLLLTNPLGSTELELNAQPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQYRLSEITYSQNGKNWKVVYGGYDTKTQPAMPANMELTDGGQRIKLKMDNWIVK
|
| GO Classification |
| component |
| cell |
| membrane |
| outer membrane |
| outer membrane (sensu Gram-negative Bacteria) |
| process |
| physiological process |
| cellular physiological process |
| transport |
| protein transport |
|
|
See more information at →
www.drugbank.ca
|