| Name |
Cytochrome b6-f complex subunit 5 |
| Synonyms |
8596 |
| Gene name |
petG |
| General function |
Involved in electron transporter, transferring electron |
| Specific function |
Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. PetG is required for either the stability or assembly of the cytochrome b6-f complex |
| Gene sequence |
+ ...
Not Available
|
| Protein sequence |
+ ...
MVEPLLDGLVLGLVFATLGGLFYAAYQQYKRPNELGG
|
| GO Classification |
| component |
| protein complex |
| cytochrome b6f complex |
| process |
| physiological process |
| metabolism |
| cellular metabolism |
| generation of precursor metabolites and energy |
| electron transport |
|
|
See more information at →
www.drugbank.ca
|