| Name |
Cytochrome b6 |
| Synonyms |
6766 |
| Gene name |
petB |
| General function |
Involved in oxidoreductase activity |
| Specific function |
Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions |
| Gene sequence |
+ ...
Not Available
|
| Protein sequence |
+ ...
MANVYDWFQERLEIQALADDVTSKYVPPHVNIFYCLGGITLTCFLIQFATGFAMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGPL
|
| GO Classification |
| component |
| cell |
| intrinsic to membrane |
| integral to membrane |
| membrane |
| function |
| transporter activity |
| electron transporter activity |
| binding |
| tetrapyrrole binding |
| catalytic activity |
| heme binding |
| oxidoreductase activity |
| ion binding |
| cation binding |
| transition metal ion binding |
| iron ion binding |
| process |
| metabolism |
| cellular metabolism |
| generation of precursor metabolites and energy |
| electron transport |
| physiological process |
|
|
See more information at →
www.drugbank.ca
|