Name |
Subtilisin Savinase |
Synonyms |
4161 |
Gene name |
Not Available |
General function |
Posttranslational modification, protein turnover, chaperones |
Specific function |
Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides |
Gene sequence |
+ ...
Not Available
|
Protein sequence |
+ ...
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
|
GO Classification |
function |
endopeptidase activity |
serine-type endopeptidase activity |
subtilase activity |
catalytic activity |
hydrolase activity |
peptidase activity |
process |
proteolysis |
physiological process |
metabolism |
macromolecule metabolism |
protein metabolism |
cellular protein metabolism |
|
See more information at →
www.drugbank.ca
|