| Name |
Methylamine dehydrogenase light chain |
| Synonyms |
9118 |
| Gene name |
mauA |
| General function |
Involved in amine dehydrogenase activity |
| Specific function |
Methylamine dehydrogenase carries out the oxidation of methylamine. Electrons are passed from methylamine dehydrogenase to amicyanin |
| Gene sequence |
+ ...
CTCGAGGCCGATAGGACCGGCTTCGCCTCGTTGCAGCAATACATGGCCAGCCGGAAGAAACAGGCGGCCTGA
|
| Protein sequence |
+ ...
MLGNFRFDDMVEKLSRRVAGQTSRRSVIGKLGTAMLGIGLVPLLPVDRRGRVSRANAADAPAGTDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASWVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
|
| GO Classification |
| component |
| periplasmic space |
| periplasmic space (sensu Gram-negative Bacteria) |
| cell |
| function |
| amine dehydrogenase activity |
| catalytic activity |
| oxidoreductase activity |
| oxidoreductase activity, acting on the CH-NH2 group of donors |
| process |
| physiological process |
| metabolism |
| cellular metabolism |
| generation of precursor metabolites and energy |
| electron transport |
|
|
See more information at →
www.drugbank.ca
|