| Name |
Pyridoxamine 5'-phosphate oxidase |
| Synonyms |
5794 |
| Gene name |
pdxH |
| General function |
Coenzyme transport and metabolism |
| Specific function |
Oxidizes PNP and PMP into pyridoxal 5'-phosphate (PLP) |
| Gene sequence |
+ ...
Not Available
|
| Protein sequence |
+ ...
MSDNDELQQIAHLRREYTKGGLRRRDLPADPLTLFERWLSQACEAKLADPTAMVVATVDEHGQPYQRIVLLKHYDEKGMVFYTNLGSRKAHQIENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQSSRISARGILESKFLELKQKFQQGEVPLPSFWGGFRVSLEQIEFWQGGEHRLHDRFLYQRENDAWKIDRLAP
|
| GO Classification |
| function |
| oxidoreductase activity, acting on the CH-NH2 group of donors |
| oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor |
| pyridoxamine-phosphate oxidase activity |
| binding |
| nucleotide binding |
| FMN binding |
| catalytic activity |
| oxidoreductase activity |
| process |
| vitamin metabolism |
| water-soluble vitamin metabolism |
| vitamin B6 metabolism |
| physiological process |
| pyridoxine metabolism |
| pyridoxine biosynthesis |
| metabolism |
| cellular metabolism |
|
|
See more information at →
www.drugbank.ca
|