Name |
Pyridoxamine 5'-phosphate oxidase |
Synonyms |
5794 |
Gene name |
pdxH |
General function |
Coenzyme transport and metabolism |
Specific function |
Oxidizes PNP and PMP into pyridoxal 5'-phosphate (PLP) |
Gene sequence |
+ ...
Not Available
|
Protein sequence |
+ ...
MSDNDELQQIAHLRREYTKGGLRRRDLPADPLTLFERWLSQACEAKLADPTAMVVATVDEHGQPYQRIVLLKHYDEKGMVFYTNLGSRKAHQIENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYFHSRPRDSQIGAWVSKQSSRISARGILESKFLELKQKFQQGEVPLPSFWGGFRVSLEQIEFWQGGEHRLHDRFLYQRENDAWKIDRLAP
|
GO Classification |
function |
oxidoreductase activity, acting on the CH-NH2 group of donors |
oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor |
pyridoxamine-phosphate oxidase activity |
binding |
nucleotide binding |
FMN binding |
catalytic activity |
oxidoreductase activity |
process |
vitamin metabolism |
water-soluble vitamin metabolism |
vitamin B6 metabolism |
physiological process |
pyridoxine metabolism |
pyridoxine biosynthesis |
metabolism |
cellular metabolism |
|
See more information at →
www.drugbank.ca
|