Name |
Phosphate-binding protein pstS precursor |
Synonyms |
3060 |
Gene name |
pstS |
General function |
Inorganic ion transport and metabolism |
Specific function |
Part of the ABC transporter complex pstSACB involved in phosphate import |
Gene sequence |
+ ...
Not Available
|
Protein sequence |
+ ...
MKVMRTTVATVVAATLSMSAFSVFAEASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
|
GO Classification |
function |
anion transporter activity |
inorganic anion transporter activity |
phosphate transporter activity |
inorganic phosphate transporter activity |
transporter activity |
ion transporter activity |
process |
phosphate transport |
physiological process |
cellular physiological process |
transport |
ion transport |
anion transport |
inorganic anion transport |
|
See more information at →
www.drugbank.ca
|